Lineage for d2ibze2 (2ibz E:31-86)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253581Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2254371Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 2254372Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins)
  6. 2254373Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species)
  7. 2254374Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81499] (7 PDB entries)
  8. 2254378Domain d2ibze2: 2ibz E:31-86 [137224]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
    automated match to d1kb9e2
    complexed with fes, hem, sma, uq6

Details for d2ibze2

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (E:) Ubiquinol-cytochrome c reductase iron-sulfur subunit, mitochondrial precursor

SCOPe Domain Sequences for d2ibze2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibze2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kstyrtpnfddvlkenndadkgrsyayfmvgamgllssagakstvetfissmtata

SCOPe Domain Coordinates for d2ibze2:

Click to download the PDB-style file with coordinates for d2ibze2.
(The format of our PDB-style files is described here.)

Timeline for d2ibze2: