SCOPe 2.06: Domain d2ibzd2: 2ibz D:261-306

Lineage for d2ibzd2 (2ibz D:261-306)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.1: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81495] (1 protein)

6. Protein Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81494] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81493] (7 PDB entries)

8. Domain d2ibzd2: 2ibz D:261-306 [137222]
   Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
   automated match to d1kyod2
   complexed with fes, hem, sma, uq6

Details for d2ibzd2

PDB Entry: 2ibz, 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin

PDB Compounds: (D:) Cytochrome c1, heme protein, mitochondrial precursor

SCOPe Domain Sequences for d2ibzd2:

Sequence; same for both SEQRES and ATOM records:

>d2ibzd2 f.23.11.1 (D:261-306) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pehderkrlglktviilsslyllsiwvkkfkwagiktrkfvfnppk

Timeline for d2ibzd2:

• d2ibzd2 first appeared in SCOP 1.73
  
• d2ibzd2 appears in SCOPe 2.05
  
• d2ibzd2 appears in SCOPe 2.07
  
• d2ibzd2 appears in the current release, SCOPe 2.08