Lineage for d2ibzc1 (2ibz C:262-385)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2255813Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2255814Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2255815Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2255816Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81645] (5 PDB entries)
  8. 2255819Domain d2ibzc1: 2ibz C:262-385 [137219]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzb1, d2ibzb2, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
    automated match to d1kb9c1
    complexed with fes, hem, sma, uq6

Details for d2ibzc1

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d2ibzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzc1 f.32.1.1 (C:262-385) Mitochondrial cytochrome b subunit, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
plvtpasivpewyllpfyailrsipdkllgvitmfaailvllvlpftdrsvvrgntfkvl
skffffifvfnfvllgqigachvevpyvlmgqiatfiyfayfliivpvistienvlfyig
rvnk

SCOPe Domain Coordinates for d2ibzc1:

Click to download the PDB-style file with coordinates for d2ibzc1.
(The format of our PDB-style files is described here.)

Timeline for d2ibzc1: