Lineage for d2ibzb2 (2ibz B:219-368)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684578Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1684579Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1684580Family d.185.1.1: MPP-like [63412] (7 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1684653Protein Cytochrome bc1 core subunit 2 [63409] (3 species)
  7. 1684654Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries)
  8. 1684662Domain d2ibzb2: 2ibz B:219-368 [137218]
    Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
    automated match to d1kb9b2
    complexed with fes, hem, sma, uq6

Details for d2ibzb2

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d2ibzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibzb2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel

SCOPe Domain Coordinates for d2ibzb2:

Click to download the PDB-style file with coordinates for d2ibzb2.
(The format of our PDB-style files is described here.)

Timeline for d2ibzb2: