| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
| Family d.185.1.1: MPP-like [63412] (6 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
| Protein Cytochrome bc1 core subunit 2 [63409] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries) |
| Domain d2ibzb2: 2ibz B:219-368 [137218] Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_ automatically matched to d1ezvb2 complexed with fes, hem, sma, uq6 |
PDB Entry: 2ibz (more details), 2.3 Å
SCOPe Domain Sequences for d2ibzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibzb2 d.185.1.1 (B:219-368) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sepkfflgeenrvrfigdsvaaigipvnkaslaqyevlanyltsalselsglissakldk
ftdgglftlfvrdqdsavvssnikkivadlkkgkdlspainytklknavqnesvsspiel
nfdavkdfklgkfnyvavgdvsnlpyldel
Timeline for d2ibzb2: