SCOPe 2.01: Domain d2ibzb1: 2ibz B:17-218

Lineage for d2ibzb1 (2ibz B:17-218)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.1: MPP-like [63412] (6 proteins)
   Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal

6. Protein Cytochrome bc1 core subunit 2 [63409] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64305] (7 PDB entries)

8. Domain d2ibzb1: 2ibz B:17-218 [137217]
   Other proteins in same PDB: d2ibza1, d2ibza2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
   automatically matched to d1ezvb1
   complexed with fes, hem, sma, uq6

Details for d2ibzb1

PDB Entry: 2ibz, 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin

PDB Compounds: (B:) Ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d2ibzb1:

Sequence; same for both SEQRES and ATOM records:

>d2ibzb1 d.185.1.1 (B:17-218) Cytochrome bc1 core subunit 2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ltvsardaptkistlavkvhggsryatkdgvahllnrfnfqntntrsalklvresellgg
tfkstldreyitlkatflkddlpyyvnaladvlyktafkpheltesvlpaarydyavaeq
cpvksaedqlyaitfrkglgnpllydgvervslqdikdfadkvytkenlevsgenvvead
lkrfvdesllstlpagkslvsk

Timeline for d2ibzb1:

• d2ibzb1 first appeared in SCOP 1.73
  
• d2ibzb1 appears in SCOP 1.75
  
• d2ibzb1 appears in SCOPe 2.02
  
• d2ibzb1 appears in the current release, SCOPe 2.08