Lineage for d2ibza1 (2ibz A:27-239)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1228134Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 1228135Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 1228136Family d.185.1.1: MPP-like [63412] (6 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 1228137Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 1228138Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64304] (7 PDB entries)
  8. 1228145Domain d2ibza1: 2ibz A:27-239 [137215]
    Other proteins in same PDB: d2ibzb1, d2ibzb2, d2ibzc1, d2ibzc2, d2ibzd1, d2ibzd2, d2ibze1, d2ibze2, d2ibzf_, d2ibzg_, d2ibzh_, d2ibzi_, d2ibzx_, d2ibzy_
    automatically matched to d1kb9a1
    complexed with fes, hem, sma, uq6

Details for d2ibza1

PDB Entry: 2ibz (more details), 2.3 Å

PDB Description: yeast cytochrome bc1 complex with stigmatellin
PDB Compounds: (A:) Ubiquinol-cytochrome-c reductase complex core protein 1

SCOPe Domain Sequences for d2ibza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibza1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava
akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk
qvqdfedndhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna
vvvgtgnikhedlvnsiesknlslqtgtkpvlk

SCOPe Domain Coordinates for d2ibza1:

Click to download the PDB-style file with coordinates for d2ibza1.
(The format of our PDB-style files is described here.)

Timeline for d2ibza1: