SCOPe 2.02: Domain d2ibxf1: 2ibx F:1-160

Lineage for d2ibxf1 (2ibx F:1-160)

1. Root: SCOPe 2.02

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (1 family)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (1 protein)

6. Protein Influenza hemagglutinin (stalk) [58066] (2 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (38 PDB entries)

8. Domain d2ibxf1: 2ibx F:1-160 [137214]
   Other proteins in same PDB: d2ibxa1, d2ibxc_, d2ibxe_
   automatically matched to 2IBX B:1-160
   complexed with nag

Details for d2ibxf1

PDB Entry: 2ibx, 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d2ibxf1:

Sequence; same for both SEQRES and ATOM records:

>d2ibxf1 h.3.1.1 (F:1-160) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp

Timeline for d2ibxf1:

• d2ibxf1 first appeared in SCOP 1.73
  
• d2ibxf1 appears in SCOPe 2.01
  
• d2ibxf1 is called d2ibxf_ in SCOPe 2.03
  
• d2ibxf1 appears in the current release, SCOPe 2.08, called d2ibxf_