Lineage for d2ibxe_ (2ibx E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117012Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1117013Superfamily b.19.1: Viral protein domain [49818] (3 families) (S)
    forms homotrimers
  5. 1117058Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1117059Protein Hemagglutinin [49824] (5 species)
    includes rudiment esterase domain
  7. 1117068Species Influenza A virus, different strains [TaxId:11320] [49825] (61 PDB entries)
  8. 1117189Domain d2ibxe_: 2ibx E: [137213]
    Other proteins in same PDB: d2ibxb1, d2ibxd1, d2ibxf1
    automated match to d1jsma_
    complexed with nag

Details for d2ibxe_

PDB Entry: 2ibx (more details), 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d2ibxe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibxe_ b.19.1.2 (E:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

SCOPe Domain Coordinates for d2ibxe_:

Click to download the PDB-style file with coordinates for d2ibxe_.
(The format of our PDB-style files is described here.)

Timeline for d2ibxe_: