SCOPe 2.08: Domain d2ibxd_: 2ibx D:

Lineage for d2ibxd_ (2ibx D:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (22 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)

8. Domain d2ibxd_: 2ibx D: [137212]
   Other proteins in same PDB: d2ibxa1, d2ibxc_, d2ibxe_
   automated match to d2ibxb1
   complexed with nag

Details for d2ibxd_

PDB Entry: 2ibx, 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha

PDB Compounds: (D:) Hemagglutinin

SCOPe Domain Sequences for d2ibxd_:

Sequence; same for both SEQRES and ATOM records:

>d2ibxd_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp

Timeline for d2ibxd_:

• d2ibxd_ first appeared in SCOP 1.73, called d2ibxd1
  
• d2ibxd_ appears in SCOPe 2.07