SCOPe 2.05: Domain d2ibxb1: 2ibx B:1-160

Lineage for d2ibxb1 (2ibx B:1-160)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein Influenza hemagglutinin (stalk) [58066] (8 species)
   trimer

7. Species Influenza A virus, different strains [TaxId:11320] [58067] (109 PDB entries)

8. Domain d2ibxb1: 2ibx B:1-160 [137210]
   Other proteins in same PDB: d2ibxa1, d2ibxc_, d2ibxe_
   complexed with nag

Details for d2ibxb1

PDB Entry: 2ibx, 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha

PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d2ibxb1:

Sequence; same for both SEQRES and ATOM records:

>d2ibxb1 h.3.1.1 (B:1-160) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwqgmvdgwygyhhsneqgsgyaadkestqkaidgvtnkvnsiidkmn
tqfeavgrefnnlerrienlnkkmedgfldvwtynaellvlmenertldfhdsnvknlyd
kvrlqlrdnakelgngcfefyhkcdnecmesvrngtydyp

Timeline for d2ibxb1:

• d2ibxb1 first appeared in SCOP 1.73
  
• d2ibxb1 appears in SCOPe 2.04
  
• d2ibxb1 appears in SCOPe 2.06
  
• d2ibxb1 appears in the current release, SCOPe 2.08