SCOPe 2.03: Domain d2ibxa1: 2ibx A:5-325

Lineage for d2ibxa1 (2ibx A:5-325)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein Hemagglutinin [49824] (6 species)
   includes rudiment esterase domain

7. Species Influenza A virus, different strains [TaxId:11320] [49825] (86 PDB entries)

8. Domain d2ibxa1: 2ibx A:5-325 [137209]
   Other proteins in same PDB: d2ibxb1, d2ibxd_, d2ibxf_
   complexed with nag

Details for d2ibxa1

PDB Entry: 2ibx, 2.8 Å

PDB Description: influenza virus (vn1194) h5 ha

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2ibxa1:

Sequence; same for both SEQRES and ATOM records:

>d2ibxa1 b.19.1.2 (A:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekthngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikknstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvngqsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlatglrnsp

Timeline for d2ibxa1:

• d2ibxa1 first appeared in SCOP 1.73
  
• d2ibxa1 appears in SCOPe 2.02
  
• d2ibxa1 appears in SCOPe 2.04
  
• d2ibxa1 appears in the current release, SCOPe 2.08