Lineage for d2ibsd1 (2ibs D:21-243)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 839581Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 839582Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families) (S)
  5. 840062Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein)
  6. 840063Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 840064Species Thermus aquaticus [TaxId:271] [53370] (12 PDB entries)
  8. 840078Domain d2ibsd1: 2ibs D:21-243 [137203]
    Other proteins in same PDB: d2ibsa2, d2ibsd2
    automatically matched to d1aqia1
    complexed with 2pr, 6ma, nea

Details for d2ibsd1

PDB Entry: 2ibs (more details), 2.4 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 2- aminopurine at the target position
PDB Compounds: (D:) modification methylase taqi

SCOP Domain Sequences for d2ibsd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibsd1 c.66.1.27 (D:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

SCOP Domain Coordinates for d2ibsd1:

Click to download the PDB-style file with coordinates for d2ibsd1.
(The format of our PDB-style files is described here.)

Timeline for d2ibsd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ibsd2