Lineage for d2ibsa1 (2ibs A:21-243)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378488Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 1378489Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1379170Family c.66.1.27: DNA methylase TaqI, N-terminal domain [88787] (1 protein)
  6. 1379171Protein DNA methylase TaqI, N-terminal domain [53369] (1 species)
  7. 1379172Species Thermus aquaticus [TaxId:271] [53370] (12 PDB entries)
  8. 1379187Domain d2ibsa1: 2ibs A:21-243 [137201]
    Other proteins in same PDB: d2ibsa2, d2ibsd2
    automatically matched to d1aqia1
    protein/DNA complex; complexed with nea

Details for d2ibsa1

PDB Entry: 2ibs (more details), 2.4 Å

PDB Description: crystal structure of the adenine-specific dna methyltransferase m.taqi complexed with the cofactor analog aeta and a 10 bp dna containing 2- aminopurine at the target position
PDB Compounds: (A:) modification methylase taqi

SCOPe Domain Sequences for d2ibsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibsa1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]}
vetppevvdfmvslaeaprggrvlepacahgpflrafreahgtayrfvgveidpkaldlp
pwaegiladfllwepgeafdlilgnppygivgeaskypihvfkavkdlykkafstwkgky
nlygaflekavrllkpggvlvfvvpatwlvledfallreflaregktsvyylgevfpqkk
vsavvirfqksgkglslwdtqesesgftpilwaeyphwegeii

SCOPe Domain Coordinates for d2ibsa1:

Click to download the PDB-style file with coordinates for d2ibsa1.
(The format of our PDB-style files is described here.)

Timeline for d2ibsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ibsa2