Lineage for d2ibnb_ (2ibn B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 927815Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 927816Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 928084Family a.211.1.4: MioX-like [140769] (1 protein)
    Pfam PF05153; DUF706
  6. 928085Protein Myo-inositol oxygenase MioX [140770] (2 species)
  7. 928086Species Human (Homo sapiens) [TaxId:9606] [140771] (1 PDB entry)
    Uniprot Q9UGB7 37-285
  8. 928088Domain d2ibnb_: 2ibn B: [137196]
    automated match to d2ibna1
    complexed with cys, fe, i1n, so4

Details for d2ibnb_

PDB Entry: 2ibn (more details), 1.5 Å

PDB Description: crystal structure of human myo-inositol oxygenase (miox)
PDB Compounds: (B:) Inositol oxygenase

SCOPe Domain Sequences for d2ibnb_:

Sequence, based on SEQRES records: (download)

>d2ibnb_ a.211.1.4 (B:) Myo-inositol oxygenase MioX {Human (Homo sapiens) [TaxId: 9606]}
smdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdesdpdvdfpn
sfhafqtaegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvv
fcdstfqdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafy
mirfhsfypwhtgrdyqqlcsqqdlamlpwvrefnkfdlytkcpdlpdvdklrpyyqgli
dkycpgilsw

Sequence, based on observed residues (ATOM records): (download)

>d2ibnb_ a.211.1.4 (B:) Myo-inositol oxygenase MioX {Human (Homo sapiens) [TaxId: 9606]}
smdrvfttyklmhthqtvdfvrskhaqfggfsykkmtvmeavdlldglvdespnsfhafq
taegirkahpdkdwfhlvgllhdlgkvlalfgepqwavvgdtfpvgcrpqasvvfcdstf
qdnpdlqdprystelgmyqphcgldrvlmswghdeymyqvmkfnkfslppeafymirfhs
fypwhtgrdyqqlcsqqdlamlpwvrefnkfdlvdklrpyyqglidkycpgilsw

SCOPe Domain Coordinates for d2ibnb_:

Click to download the PDB-style file with coordinates for d2ibnb_.
(The format of our PDB-style files is described here.)

Timeline for d2ibnb_: