SCOPe 2.06: Domain d2ibba1: 2ibb A:573-676

Lineage for d2ibba1 (2ibb A:573-676)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Hedgehog receptor iHog [141061] (1 species)
   Cg9211-PA

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [141062] (3 PDB entries)
   Uniprot Q9VM64 466-572! Uniprot Q9VM64 573-667

8. Domain d2ibba1: 2ibb A:573-676 [137180]
   Other proteins in same PDB: d2ibba3
   automated match to d2ibgb1
   complexed with so4

Details for d2ibba1

PDB Entry: 2ibb, 2.4 Å

PDB Description: crystal structure of the first and second fniii domains of ihog

PDB Compounds: (A:) cg9211-pa

SCOPe Domain Sequences for d2ibba1:

Sequence, based on SEQRES records:

>d2ibba1 b.1.2.1 (A:573-676) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gaaldpmpvpelleieeysetavvlhwslasdadehlitgyyayyrpsssageyfkatie
gaharsfkiapletatmyefklqsfsaasasefsalkqgrtqrp

Sequence, based on observed residues (ATOM records):

>d2ibba1 b.1.2.1 (A:573-676) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
gaaldpmpvpelleieeysetavvlhwslahlitgyyayyrpsssageyfkatiegahar
sfkiapletatmyefklqsfsaasasefsalkqgrtqrp

Timeline for d2ibba1:

• d2ibba1 first appeared in SCOP 1.73
  
• d2ibba1 appears in SCOPe 2.05
  
• d2ibba1 appears in SCOPe 2.07
  
• d2ibba1 appears in the current release, SCOPe 2.08