Lineage for d2ianq2 (2ian Q:3-92)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1641763Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1642475Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1642485Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (17 PDB entries)
  8. 1642507Domain d2ianq2: 2ian Q:3-92 [137177]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb1, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang1, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl1, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ians1, d2ians2, d2iant1, d2iant2
    automated match to d1klub2
    mutant

Details for d2ianq2

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (Q:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2ianq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ianq2 d.19.1.1 (Q:3-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
trprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaeywn
sqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2ianq2:

Click to download the PDB-style file with coordinates for d2ianq2.
(The format of our PDB-style files is described here.)

Timeline for d2ianq2: