Lineage for d2ianq1 (2ian Q:93-190)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358779Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 2358787Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (43 PDB entries)
    Uniprot P04229 30-219
    probably orthologous to the mouse I-E group
  8. 2358825Domain d2ianq1: 2ian Q:93-190 [137176]
    Other proteins in same PDB: d2iana1, d2iana2, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2
    automated match to d1klub1
    mutant

Details for d2ianq1

PDB Entry: 2ian (more details), 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR
PDB Compounds: (Q:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2ianq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ianq1 b.1.1.2 (Q:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewra

SCOPe Domain Coordinates for d2ianq1:

Click to download the PDB-style file with coordinates for d2ianq1.
(The format of our PDB-style files is described here.)

Timeline for d2ianq1: