SCOPe 2.05: Domain d2ianp1: 2ian P:82-181

Lineage for d2ianp1 (2ian P:82-181)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (37 PDB entries)
   Uniprot P01903 28-207
   probably orthologous to the mouse I-E group

8. Domain d2ianp1: 2ian P:82-181 [137174]
   Other proteins in same PDB: d2iana2, d2ianb1, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf2, d2iang1, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2
   automated match to d1jwua1
   mutant

Details for d2ianp1

PDB Entry: 2ian, 2.8 Å

PDB Description: Structural basis for recognition of mutant self by a tumor-specific, MHC class II-restricted TCR

PDB Compounds: (P:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2ianp1:

Sequence; same for both SEQRES and ATOM records:

>d2ianp1 b.1.1.2 (P:82-181) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d2ianp1:

• d2ianp1 first appeared in SCOP 1.73
  
• d2ianp1 appears in SCOPe 2.04
  
• d2ianp1 appears in SCOPe 2.06
  
• d2ianp1 appears in the current release, SCOPe 2.08