Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
Domain d2iang1: 2ian G:93-190 [137168] Other proteins in same PDB: d2iana1, d2iana2, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iang2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2 automated match to d1klub1 mutant |
PDB Entry: 2ian (more details), 2.8 Å
SCOPe Domain Sequences for d2iang1:
Sequence, based on SEQRES records: (download)
>d2iang1 b.1.1.2 (G:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d2iang1 b.1.1.2 (G:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypshnllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlv mletvprsgevytcqvehpsvtspltvewra
Timeline for d2iang1:
View in 3D Domains from other chains: (mouse over for more information) d2iana1, d2iana2, d2ianb1, d2ianb2, d2iand1, d2iand2, d2iane1, d2iane2, d2ianf1, d2ianf2, d2iani1, d2iani2, d2ianj1, d2ianj2, d2iank1, d2iank2, d2ianl1, d2ianl2, d2iann1, d2iann2, d2iano1, d2iano2, d2ianp1, d2ianp2, d2ianq1, d2ianq2, d2ians1, d2ians2, d2iant1, d2iant2 |