Lineage for d2iamb2 (2iam B:1-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545431Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 2545441Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [88821] (20 PDB entries)
  8. 2545457Domain d2iamb2: 2iam B:1-92 [137161]
    Other proteins in same PDB: d2iama1, d2iama2, d2iamb1, d2iamc1, d2iamc2, d2iamd1, d2iamd2
    automated match to d1klub2
    mutant

Details for d2iamb2

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2iamb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iamb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR1 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2iamb2:

Click to download the PDB-style file with coordinates for d2iamb2.
(The format of our PDB-style files is described here.)

Timeline for d2iamb2: