Lineage for d2iamb2 (2iam B:1-92)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198561Protein Class II MHC beta chain, N-terminal domain [88819] (15 species)
  7. 1198614Species Human (Homo sapiens), HLA-DR4 [TaxId:9606] [88824] (12 PDB entries)
  8. 1198624Domain d2iamb2: 2iam B:1-92 [137161]
    Other proteins in same PDB: d2iama1, d2iama2, d2iamb1
    automatically matched to d1d5xb2
    mutant

Details for d2iamb2

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
PDB Compounds: (B:) HLA class II histocompatibility antigen, DRB1-1 beta chain

SCOPe Domain Sequences for d2iamb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iamb2 d.19.1.1 (B:1-92) Class II MHC beta chain, N-terminal domain {Human (Homo sapiens), HLA-DR4 [TaxId: 9606]}
gdtrprflwqlkfechffngtervrllerciynqeesvrfdsdvgeyravtelgrpdaey
wnsqkdlleqrraavdtycrhnygvgesftvq

SCOPe Domain Coordinates for d2iamb2:

Click to download the PDB-style file with coordinates for d2iamb2.
(The format of our PDB-style files is described here.)

Timeline for d2iamb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iamb1