Lineage for d2iama2 (2iam A:13-81)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1020838Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1020839Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1020840Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1021292Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 1021365Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (17 PDB entries)
  8. 1021377Domain d2iama2: 2iam A:13-81 [137159]
    Other proteins in same PDB: d2iama1, d2iamb1, d2iamb2
    automatically matched to d1k2da2
    mutant

Details for d2iama2

PDB Entry: 2iam (more details), 2.8 Å

PDB Description: structural basis for recognition of mutant self by a tumor-specific, mhc class ii-restricted tcr
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d2iama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iama2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

SCOPe Domain Coordinates for d2iama2:

Click to download the PDB-style file with coordinates for d2iama2.
(The format of our PDB-style files is described here.)

Timeline for d2iama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iama1