![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
![]() | Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) |
![]() | Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (11 PDB entries) |
![]() | Domain d2iama2: 2iam A:13-81 [137159] Other proteins in same PDB: d2iama1, d2iamb1, d2iamb2 automatically matched to d1k2da2 mutant |
PDB Entry: 2iam (more details), 2.8 Å
SCOP Domain Sequences for d2iama2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iama2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]} ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei mtkrsnytp
Timeline for d2iama2: