SCOP 1.73: Domain d2ia5h1: 2ia5 H:153-301

Lineage for d2ia5h1 (2ia5 H:153-301)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.9: phosphatase domain of polynucleotide kinase [82385] (2 proteins)
   no insertion subdomains

6. Protein Polynucleotide kinase, phosphatase domain [82386] (1 species)

7. Species Bacteriophage T4 [TaxId:10665] [82387] (5 PDB entries)

8. Domain d2ia5h1: 2ia5 H:153-301 [137147]
   Other proteins in same PDB: d2ia5a2, d2ia5b2, d2ia5c2, d2ia5d2, d2ia5e2, d2ia5f2, d2ia5g2, d2ia5h2, d2ia5i2, d2ia5j2, d2ia5k2, d2ia5l2
   automatically matched to d1ltqa1
   complexed with ars, mg, so4

Details for d2ia5h1

PDB Entry: 2ia5, 2.9 Å

PDB Description: t4 polynucleotide kinase/phosphatase with bound sulfate and magnesium.

PDB Compounds: (H:) Polynucleotide kinase

SCOP Domain Sequences for d2ia5h1:

Sequence; same for both SEQRES and ATOM records:

>d2ia5h1 c.108.1.9 (H:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]}
ngtpgkpkavifdvdgtlakmngrgpydlekcdtdvinpmvvelskmyalmgyqivvvsg
resgtkedptkyyrmtrkwvediagvplvmqcqreqgdtrkddvvkeeifwkhiaphfdv
klaiddrtqvvemwrrigvecwqvasgdf

Timeline for d2ia5h1:

• d2ia5h1 is new in SCOP 1.73
  
• d2ia5h1 appears in SCOP 1.75
  
• d2ia5h1 appears in the current release, SCOPe 2.08