Lineage for d2i9bd1 (2i9b D:11-49)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031536Protein Plasminogen activator (urokinase-type) [57221] (1 species)
  7. 3031537Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries)
  8. 3031546Domain d2i9bd1: 2i9b D:11-49 [137124]
    Other proteins in same PDB: d2i9ba2, d2i9bb2, d2i9bc2, d2i9bd2, d2i9be1, d2i9be2, d2i9be3, d2i9be4, d2i9bf1, d2i9bf2, d2i9bf3, d2i9bf4, d2i9bg1, d2i9bg2, d2i9bg3, d2i9bh1, d2i9bh2, d2i9bh3
    automated match to d1urka1
    complexed with so4

Details for d2i9bd1

PDB Entry: 2i9b (more details), 2.8 Å

PDB Description: crystal structure of atf-urokinase receptor complex
PDB Compounds: (D:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d2i9bd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i9bd1 g.3.11.1 (D:11-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]}
cdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt

SCOPe Domain Coordinates for d2i9bd1:

Click to download the PDB-style file with coordinates for d2i9bd1.
(The format of our PDB-style files is described here.)

Timeline for d2i9bd1: