SCOPe 2.06: Domain d2i9bc2: 2i9b C:50-132

Lineage for d2i9bc2 (2i9b C:50-132)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.1: Kringle modules [57441] (7 proteins)

6. Protein Urokinase-type plasminogen activator [57453] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57454] (7 PDB entries)

8. Domain d2i9bc2: 2i9b C:50-132 [137123]
   Other proteins in same PDB: d2i9ba1, d2i9bb1, d2i9bc1, d2i9bd1, d2i9be1, d2i9be2, d2i9be3, d2i9be4, d2i9bf1, d2i9bf2, d2i9bf3, d2i9bf4, d2i9bg1, d2i9bg2, d2i9bg3, d2i9bh1, d2i9bh2, d2i9bh3
   automated match to d1urka2
   complexed with so4

Details for d2i9bc2

PDB Entry: 2i9b, 2.8 Å

PDB Description: crystal structure of atf-urokinase receptor complex

PDB Compounds: (C:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d2i9bc2:

Sequence; same for both SEQRES and ATOM records:

>d2i9bc2 g.14.1.1 (C:50-132) Urokinase-type plasminogen activator {Human (Homo sapiens) [TaxId: 9606]}
cyegnghfyrgkastdtmgrpclpwnsatvlqqtyhahrsdalqlglgkhnycrnpdnrr
rpwcyvqvglkplvqecmvhdca

Timeline for d2i9bc2:

• d2i9bc2 first appeared in SCOP 1.73
  
• d2i9bc2 appears in SCOPe 2.05
  
• d2i9bc2 appears in SCOPe 2.07
  
• d2i9bc2 appears in the current release, SCOPe 2.08