Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (22 proteins) |
Protein Plasminogen activator (urokinase-type) [57221] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57222] (6 PDB entries) |
Domain d2i9bc1: 2i9b C:11-49 [137122] Other proteins in same PDB: d2i9ba2, d2i9bb2, d2i9bc2, d2i9bd2, d2i9be1, d2i9be2, d2i9be3, d2i9bf1, d2i9bf2, d2i9bf3, d2i9bg1, d2i9bg2, d2i9bg3, d2i9bh1, d2i9bh2, d2i9bh3 automatically matched to d1urk_1 complexed with bma, nag, so4; mutant |
PDB Entry: 2i9b (more details), 2.8 Å
SCOP Domain Sequences for d2i9bc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i9bc1 g.3.11.1 (C:11-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} cdclnggtcvsnkyfsnihwcncpkkfggqhceidkskt
Timeline for d2i9bc1: