Lineage for d2i6ga1 (2i6g A:1-198)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2145089Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2145090Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2146306Family c.66.1.44: TehB-like [142603] (2 proteins)
    Pfam PF03848; overall structural similarity to Thiopurine S-methyltransferase (Pfam PF05724)
  6. 2146307Protein Putative methyltransferase TehB [142604] (1 species)
    Tellurite resistance protein
  7. 2146308Species Salmonella typhimurium [TaxId:90371] [142605] (1 PDB entry)
    Uniprot Q8ZPC3 1-198
    sequence similarity to Hypothetical methyltransferase PH1305 of the CAC2371-like family (117688)
  8. 2146309Domain d2i6ga1: 2i6g A:1-198 [137096]
    Other proteins in same PDB: d2i6ga2, d2i6gb3
    complexed with acy, cl, edo

Details for d2i6ga1

PDB Entry: 2i6g (more details), 1.9 Å

PDB Description: crystal structure of a putative methyltransferase (tehb, stm1608) from salmonella typhimurium lt2 at 1.90 a resolution
PDB Compounds: (A:) Putative methyltransferase

SCOPe Domain Sequences for d2i6ga1:

Sequence, based on SEQRES records: (download)

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}
mtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawdk
npasmanlerikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglianm
qrctkpggynlivaamdtpdfpctvgfpfafkegelrryyegwdmlkynedvgelhrtde
ngnriklrfatmlarkta

Sequence, based on observed residues (ATOM records): (download)

>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]}
mtvrdenyftekygltrthsdvlaaakvvapgrtldlgcgngrnslylaangydvtawdk
npasmanlerikaaegldnlqtdlvdlntltfdgeydfilstvvmmfleaqtipglianm
qrctkpggynlivaamdfpfafkegelrryyegwdmlkynedvgklrfatmlarkta

SCOPe Domain Coordinates for d2i6ga1:

Click to download the PDB-style file with coordinates for d2i6ga1.
(The format of our PDB-style files is described here.)

Timeline for d2i6ga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2i6ga2