Lineage for d2i60g1 (2i60 G:86-492)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 878722Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 878723Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 878724Family d.172.1.1: gp120 core [56503] (1 protein)
  6. 878725Protein gp120 core [56504] (1 species)
  7. 878726Species Human immunodeficiency virus type 1 [TaxId:11676] [56505] (20 PDB entries)
  8. 878739Domain d2i60g1: 2i60 G:86-492 [137081]
    Other proteins in same PDB: d2i60h1, d2i60h2, d2i60l1, d2i60l2, d2i60m1, d2i60q1, d2i60q2, d2i60r1, d2i60r2, d2i60s1
    automatically matched to d1g9ng_
    complexed with ipa, mpt, nag, ndg, vlm

Details for d2i60g1

PDB Entry: 2i60 (more details), 2.4 Å

PDB Description: crystal structure of [phe23]m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (G:) Exterior membrane glycoprotein(GP120)

SCOP Domain Sequences for d2i60g1:

Sequence, based on SEQRES records: (download)

>d2i60g1 d.172.1.1 (G:86-492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
lenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacpkvs
fepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeee
ivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqiinm
wqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselyky
kvvkie

Sequence, based on observed residues (ATOM records): (download)

>d2i60g1 d.172.1.1 (G:86-492) gp120 core {Human immunodeficiency virus type 1 [TaxId: 11676]}
lenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacpkvs
fepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngslaeee
ivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgnnkt
iifnpssggdpeivthsfncggeffycnstqlftwndrnitlpcrikqiinmwqevgkam
yappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie

SCOP Domain Coordinates for d2i60g1:

Click to download the PDB-style file with coordinates for d2i60g1.
(The format of our PDB-style files is described here.)

Timeline for d2i60g1: