Lineage for d2i5yp2 (2i5y P:83-492)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2236004Fold d.172: gp120 core [56501] (1 superfamily)
    unusual fold
  4. 2236005Superfamily d.172.1: gp120 core [56502] (1 family) (S)
  5. 2236006Family d.172.1.1: gp120 core [56503] (2 proteins)
  6. 2236007Protein gp120 core [56504] (2 species)
  7. 2236029Species Human immunodeficiency virus [TaxId:12721] [190021] (1 PDB entry)
  8. 2236031Domain d2i5yp2: 2i5y P:83-492 [137076]
    Other proteins in same PDB: d2i5yg3, d2i5yh1, d2i5yh2, d2i5yl1, d2i5yl2, d2i5ym1, d2i5yp3, d2i5yq1, d2i5yq2, d2i5yr1, d2i5yr2, d2i5ys1
    automated match to d1g9ng_
    complexed with nag, ndg

Details for d2i5yp2

PDB Entry: 2i5y (more details), 2.2 Å

PDB Description: crystal structure of cd4m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (P:) Exterior membrane glycoprotein(GP120)

SCOPe Domain Sequences for d2i5yp2:

Sequence, based on SEQRES records: (download)

>d2i5yp2 d.172.1.1 (P:83-492) gp120 core {Human immunodeficiency virus [TaxId: 12721]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwndtrklnntgrnitlpcrikqi
inmwqevgkamyappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrsel
ykykvvkie

Sequence, based on observed residues (ATOM records): (download)

>d2i5yp2 d.172.1.1 (P:83-492) gp120 core {Human immunodeficiency virus [TaxId: 12721]}
evklenvtenfnmwknnmveqmhediislwdqslkpcvkltplcvgagscntsvitqacp
kvsfepipihycapagfailkcndkkfngtgpctnvstvqcthgirpvvstqlllngsla
eeeivirsenftnnaktiivqlnesvvinctgaghcnlsktqwentleqiaiklkeqfgn
nktiifnpssggdpeivthsfncggeffycnstqlftwrnitlpcrikqiinmwqevgka
myappirgqircssnitgllltrdggkdtngteifrpgggdmrdnwrselykykvvkie

SCOPe Domain Coordinates for d2i5yp2:

Click to download the PDB-style file with coordinates for d2i5yp2.
(The format of our PDB-style files is described here.)

Timeline for d2i5yp2: