Lineage for d2i5yh2 (2i5y H:114-214)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1515183Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 1515187Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 1515257Domain d2i5yh2: 2i5y H:114-214 [137073]
    Other proteins in same PDB: d2i5yg_, d2i5yh1, d2i5yl1, d2i5yl2, d2i5ym1, d2i5yp_, d2i5yq1, d2i5yq2, d2i5yr1, d2i5ys1
    automatically matched to d1ngzb2
    complexed with nag, ndg

Details for d2i5yh2

PDB Entry: 2i5y (more details), 2.2 Å

PDB Description: crystal structure of cd4m47, a scorpion-toxin mimic of cd4, in complex with hiv-1 yu2 gp120 envelope glycoprotein and anti-hiv-1 antibody 17b
PDB Compounds: (H:) Antibody 17B Heavy chain

SCOPe Domain Sequences for d2i5yh2:

Sequence, based on SEQRES records: (download)

>d2i5yh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records): (download)

>d2i5yh2 b.1.1.2 (H:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOPe Domain Coordinates for d2i5yh2:

Click to download the PDB-style file with coordinates for d2i5yh2.
(The format of our PDB-style files is described here.)

Timeline for d2i5yh2: