SCOPe 2.01: Domain d2i5nl_: 2i5n L:

Lineage for d2i5nl_ (2i5n L:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Blastochloris viridis [TaxId:1079] [187141] (5 PDB entries)

8. Domain d2i5nl_: 2i5n L: [137066]
   Other proteins in same PDB: d2i5nc_, d2i5nh1, d2i5nh2
   automated match to d1prcl_
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nl_

PDB Entry: 2i5n, 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2i5nl_:

Sequence; same for both SEQRES and ATOM records:

>d2i5nl_ f.26.1.1 (L:) automated matches {Blastochloris viridis [TaxId: 1079]}
allsferkyrvrggtliggdlfdfwvgpyfvgffgvsaiffiflgvsligyaasqgptwd
pfaisinppdlkyglgaaplleggfwqaitvcalgafiswmlreveisrklgigwhvpla
fcvpifmfcvlqvfrplllgswghafpygilshldwvnnfgyqylnwhynpghmssvsfl
fvnamalglhgglilsvanpgdgdkvktaehenqyfrdvvgysigalsihrlglflasni
fltgafgtiasgpfwtrgwpewwgwwldipfws

Timeline for d2i5nl_:

• d2i5nl_ first appeared in SCOP 1.73, called d2i5nl1
  
• d2i5nl_ was called d2i5nl1 in SCOP 1.75
  
• d2i5nl_ appears in SCOPe 2.02
  
• d2i5nl_ appears in the current release, SCOPe 2.08