SCOPe 2.08: Domain d2i5nh2: 2i5n H:1-36

Lineage for d2i5nh2 (2i5n H:1-36)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families)

5. Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)

6. Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)

7. Species Rhodopseudomonas viridis [TaxId:1079] [81485] (26 PDB entries)
   synonym: blastochloris viridis

8. Domain d2i5nh2: 2i5n H:1-36 [137065]
   Other proteins in same PDB: d2i5nc_, d2i5nh1, d2i5nl_, d2i5nm_
   automated match to d6prch2
   complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nh2

PDB Entry: 2i5n, 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2i5nh2:

Sequence; same for both SEQRES and ATOM records:

>d2i5nh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

Timeline for d2i5nh2:

• d2i5nh2 first appeared in SCOP 1.73
  
• d2i5nh2 appears in SCOPe 2.07