Lineage for d2i5nh2 (2i5n H:1-36)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577985Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2578573Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 2578574Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 2578575Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 2578671Species Rhodopseudomonas viridis [TaxId:1079] [81485] (19 PDB entries)
    synonym: blastochloris viridis
  8. 2578673Domain d2i5nh2: 2i5n H:1-36 [137065]
    Other proteins in same PDB: d2i5nc_, d2i5nh1, d2i5nl_, d2i5nm_
    automated match to d6prch2
    complexed with bcb, bpb, fe2, hec, hto, lda, mq9, ns5, so4, unl, uq1

Details for d2i5nh2

PDB Entry: 2i5n (more details), 1.96 Å

PDB Description: 1.96 A X-ray structure of photosynthetic reaction center from Rhodopseudomonas viridis:Crystals grown by microfluidic technique
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2i5nh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i5nh2 f.23.10.1 (H:1-36) Photosystem II reaction centre subunit H, transmembrane region {Rhodopseudomonas viridis [TaxId: 1079]}
myhgalaqhldiaqlvwyaqwlviwtvvllylrred

SCOPe Domain Coordinates for d2i5nh2:

Click to download the PDB-style file with coordinates for d2i5nh2.
(The format of our PDB-style files is described here.)

Timeline for d2i5nh2: