Lineage for d2i4ja_ (2i4j A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1280249Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1280250Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1280251Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48525] (82 PDB entries)
    Uniprot P37231 232-505
  8. 1280737Domain d2i4ja_: 2i4j A: [137049]
    automated match to d1nyxa_
    complexed with drj

Details for d2i4ja_

PDB Entry: 2i4j (more details), 2.1 Å

PDB Description: crystal structure of the complex between ppargamma and the agonist lt160 (ureidofibrate derivative)
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d2i4ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i4ja_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d2i4ja_:

Click to download the PDB-style file with coordinates for d2i4ja_.
(The format of our PDB-style files is described here.)

Timeline for d2i4ja_: