SCOPe 2.06: Domain d2i40d2: 2i40 D:310-432

Lineage for d2i40d2 (2i40 D:310-432)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (81 PDB entries)
   Uniprot P20248 175-432

8. Domain d2i40d2: 2i40 D:310-432 [137043]
   Other proteins in same PDB: d2i40a_, d2i40c_
   automated match to d1jsub2
   complexed with blz

Details for d2i40d2

PDB Entry: 2i40, 2.8 Å

PDB Description: Cdk2/Cyclin A complexed with a thiophene carboxamide inhibitor

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d2i40d2:

Sequence; same for both SEQRES and ATOM records:

>d2i40d2 a.74.1.1 (D:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d2i40d2:

• d2i40d2 first appeared in SCOP 1.73
  
• d2i40d2 appears in SCOPe 2.05
  
• d2i40d2 appears in SCOPe 2.07
  
• d2i40d2 appears in the current release, SCOPe 2.08