Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.4: Ribosomal protein L16p/L10e [54686] (2 families) |
Family d.41.4.2: Ribosomal protein L16p [117888] (1 protein) Pfam PF00252 |
Protein Ribosomal protein L16p [117889] (2 species) |
Species Escherichia coli [TaxId:562] [143200] (9 PDB entries) |
Domain d2i2vm1: 2i2v M:1-136 [137013] Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vl1, d2i2vp1, d2i2vr1, d2i2vu1, d2i2vv1, d2i2vy1 automatically matched to 2AW4 M:1-136 complexed with mg, zn |
PDB Entry: 2i2v (more details), 3.22 Å
SCOP Domain Sequences for d2i2vm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2vm1 d.41.4.2 (M:1-136) Ribosomal protein L16p {Escherichia coli [TaxId: 562]} mlqpkrtkfrkmhkgrnrglaqgtdvsfgsfglkavgrgrltarqieaarramtravkrq gkiwirvfpdkpitekplavrmgkgkgnveywvaliqpgkvlyemdgvpeelareafkla aaklpikttfvtktvm
Timeline for d2i2vm1: