Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) |
Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
Protein Ribosomal protein L15 (L15p) [52082] (2 species) |
Species Escherichia coli [TaxId:562] [141994] (9 PDB entries) |
Domain d2i2vl1: 2i2v L:2-144 [137012] Other proteins in same PDB: d2i2v01, d2i2v11, d2i2v21, d2i2v31, d2i2v41, d2i2vm1, d2i2vp1, d2i2vr1, d2i2vu1, d2i2vv1, d2i2vy1 automatically matched to 2AW4 L:1-144 complexed with mg, zn |
PDB Entry: 2i2v (more details), 3.22 Å
SCOP Domain Sequences for d2i2vl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2vl1 c.12.1.1 (L:2-144) Ribosomal protein L15 (L15p) {Escherichia coli [TaxId: 562]} rlntlspaegskkagkrlgrgigsglgktggrghkgqksrsgggvrrgfeggqmplyrrl pkfgftsrkaaitaeirlsdlakveggvvdlntlkaaniigiqiefakvilagevttpvt vrglrvtkgaraaieaaggkiee
Timeline for d2i2vl1: