| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() |
| Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
| Protein Ribosomal protein S8 [56049] (4 species) |
| Species Escherichia coli [TaxId:562] [111186] (9 PDB entries) Uniprot P02361 |
| Domain d2i2ph1: 2i2p H:3-129 [136993] Other proteins in same PDB: d2i2pb1, d2i2pc1, d2i2pc2, d2i2pd1, d2i2pe1, d2i2pe2, d2i2pf1, d2i2pg1, d2i2pi1, d2i2pj1, d2i2pk1, d2i2pl1, d2i2pm1, d2i2pn1, d2i2po1, d2i2pp1, d2i2pq1, d2i2pr1, d2i2ps1, d2i2pt1, d2i2pu1 automatically matched to d1s03h_ complexed with mg |
PDB Entry: 2i2p (more details), 3.22 Å
SCOP Domain Sequences for d2i2ph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i2ph1 d.140.1.1 (H:3-129) Ribosomal protein S8 {Escherichia coli [TaxId: 562]}
qdpiadmltrirngqaankaavtmpssklkvaianvlkeegfiedfkvegdtkpeleltl
kyfqgkavvesiqrvsrpglriykrkdelpkvmaglgiavvstskgvmtdraarqaglgg
eiicyva
Timeline for d2i2ph1: