Lineage for d2i0qb1 (2i0q B:9-224)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668089Protein Core domain of telomere end binding protein beta subunit [50275] (1 species)
  7. 668090Species Oxytricha nova [TaxId:200597] [50276] (14 PDB entries)
  8. 668092Domain d2i0qb1: 2i0q B:9-224 [136959]
    Other proteins in same PDB: d2i0qa1, d2i0qa2, d2i0qa3
    automatically matched to d1ph1b_
    complexed with cl, edo

Details for d2i0qb1

PDB Entry: 2i0q (more details), 1.91 Å

PDB Description: Crystal structure of a telomere single-strand DNA-protein complex from O. nova with full-length alpha and beta telomere proteins
PDB Compounds: (B:) Telomere-binding protein beta subunit

SCOP Domain Sequences for d2i0qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i0qb1 b.40.4.3 (B:9-224) Core domain of telomere end binding protein beta subunit {Oxytricha nova [TaxId: 200597]}
qqqsafkqlytelfnnegdfskvssnlkkplkcyvkesyphflvtdgyffvapyftkeav
nefhakfpnvnivdltdkvivinnwslelrrvnsaevftsyanlearlivhsfkpnlqer
lnptrypvnlfrddefkttiqhfrhtalqaainktvkgdnlvdiskvadaagkkgkvdag
ivkasaskgdefsdfsfkegntatlkiadifvqekg

SCOP Domain Coordinates for d2i0qb1:

Click to download the PDB-style file with coordinates for d2i0qb1.
(The format of our PDB-style files is described here.)

Timeline for d2i0qb1: