Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.8: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63433] (1 family) |
Family b.34.8.1: Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63434] (1 protein) contains 5 short helices in the loop between the third and fourth strands |
Protein Fumarylacetoacetate hydrolase, FAH, N-terminal domain [63435] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [63436] (5 PDB entries) |
Domain d2hzyb1: 2hzy B:1-118 [136934] Other proteins in same PDB: d2hzya2, d2hzyb2 automatically matched to d1hyob1 complexed with ca, dhj, mn, na, ni |
PDB Entry: 2hzy (more details), 1.35 Å
SCOP Domain Sequences for d2hzyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzyb1 b.34.8.1 (B:1-118) Fumarylacetoacetate hydrolase, FAH, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} msfipvaedsdfpiqnlpygvfstqsnpkprigvaigdqildlsvikhlftgpalskhqh vfdettlnnfmglgqaawkearaslqnllsasqarlrddkelrqraftsqasatmhlp
Timeline for d2hzyb1: