Lineage for d2hzya2 (2hzy A:119-416)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2610574Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 2610575Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 2610576Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 2610606Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)
  7. 2610607Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries)
  8. 2610610Domain d2hzya2: 2hzy A:119-416 [136933]
    Other proteins in same PDB: d2hzya1, d2hzyb1, d2hzyb3
    automated match to d1hyoa2
    complexed with ca, dhj, mn, na, ni

Details for d2hzya2

PDB Entry: 2hzy (more details), 1.35 Å

PDB Description: Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate
PDB Compounds: (A:) Fumarylacetoacetase

SCOPe Domain Sequences for d2hzya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzya2 d.177.1.1 (A:119-416) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal

SCOPe Domain Coordinates for d2hzya2:

Click to download the PDB-style file with coordinates for d2hzya2.
(The format of our PDB-style files is described here.)

Timeline for d2hzya2: