Lineage for d2hzya2 (2hzy A:119-416)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 738881Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 738882Superfamily d.177.1: FAH [56529] (1 family) (S)
  5. 738883Family d.177.1.1: FAH [56530] (6 proteins)
  6. 738913Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species)
  7. 738914Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries)
  8. 738917Domain d2hzya2: 2hzy A:119-416 [136933]
    Other proteins in same PDB: d2hzya1, d2hzyb1
    automatically matched to d1qcnb2
    complexed with ca, dhj, mn, na, ni

Details for d2hzya2

PDB Entry: 2hzy (more details), 1.35 Å

PDB Description: Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate
PDB Compounds: (A:) Fumarylacetoacetase

SCOP Domain Sequences for d2hzya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hzya2 d.177.1.1 (A:119-416) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg
qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard
iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin
lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes
fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal

SCOP Domain Coordinates for d2hzya2:

Click to download the PDB-style file with coordinates for d2hzya2.
(The format of our PDB-style files is described here.)

Timeline for d2hzya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hzya1