![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
![]() | Superfamily d.177.1: FAH [56529] (2 families) ![]() |
![]() | Family d.177.1.1: FAH [56530] (7 proteins) automatically mapped to Pfam PF01557 |
![]() | Protein Fumarylacetoacetate hydrolase, FAH, C-terminal domain [63432] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [56532] (5 PDB entries) |
![]() | Domain d2hzya2: 2hzy A:119-416 [136933] Other proteins in same PDB: d2hzya1, d2hzyb1, d2hzyb3 automated match to d1hyoa2 complexed with ca, dhj, mn, na, ni |
PDB Entry: 2hzy (more details), 1.35 Å
SCOPe Domain Sequences for d2hzya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hzya2 d.177.1.1 (A:119-416) Fumarylacetoacetate hydrolase, FAH, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} atigdytdfyssrqhatnvgimfrgkenallpnwlhlpvgyhgrassivvsgtpirrpmg qmrpdnskppvygacrlldmelemaffvgpgnrfgepipiskahehifgmvlmndwsard iqqweyvplgpflgksfgttispwvvpmdalmpfvvpnpkqdpkplpylchsqpytfdin lsvslkgegmsqaaticrsnfkhmywtmlqqlthhsvngcnlrpgdllasgtisgsdpes fgsmlelswkgtkaidvgqgqtrtflldgdeviitghcqgdgyrvgfgqcagkvlpal
Timeline for d2hzya2: