Lineage for d2hzna_ (2hzn A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1929262Protein Abelsone tyrosine kinase (abl) [56166] (2 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. Species Mouse (Mus musculus) [TaxId:10090] [56167] (7 PDB entries)
  8. 1929286Domain d2hzna_: 2hzn A: [136915]
    automated match to d1opjb_
    complexed with kin

Details for d2hzna_

PDB Entry: 2hzn (more details), 2.7 Å

PDB Description: abl kinase domain in complex with nvp-afg210
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d2hzna_:

Sequence, based on SEQRES records: (download)

>d2hzna_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
pekvyelmracwqwnpsdrpsfaeihqafetmfqessi

Sequence, based on observed residues (ATOM records): (download)

>d2hzna_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
mdpsspnydkwemertditmkhklgggevyegvwkkysltvavktldtmeveeflkeaav
mkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqiss
ameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtape
slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
elmracwqwnpsdrpsfaeihqafetmfqessi

SCOPe Domain Coordinates for d2hzna_:

Click to download the PDB-style file with coordinates for d2hzna_.
(The format of our PDB-style files is described here.)

Timeline for d2hzna_: