Lineage for d2hzna1 (2hzn A:225-502)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 874255Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 874256Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 874317Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 874333Protein Abelsone tyrosine kinase (abl) [56166] (1 species)
    PTK group; Abl subfamily; non-membrane spanning protein tyrosine kinase
  7. 874334Species Mouse (Mus musculus) [TaxId:10090] [56167] (9 PDB entries)
  8. 874349Domain d2hzna1: 2hzn A:225-502 [136915]
    automatically matched to d1opjb_
    complexed with kin

Details for d2hzna1

PDB Entry: 2hzn (more details), 2.7 Å

PDB Description: abl kinase domain in complex with nvp-afg210
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase ABL1

SCOP Domain Sequences for d2hzna1:

Sequence, based on SEQRES records: (download)

>d2hzna1 d.144.1.7 (A:225-502) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
mdpsspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveefl
keaavmkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllyma
tqissameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpik
wtapeslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegc
pekvyelmracwqwnpsdrpsfaeihqafetmfqessi

Sequence, based on observed residues (ATOM records): (download)

>d2hzna1 d.144.1.7 (A:225-502) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]}
mdpsspnydkwemertditmkhklgggevyegvwkkysltvavktldtmeveeflkeaav
mkeikhpnlvqllgvctreppfyiitefmtygnlldylrecnrqevsavvllymatqiss
ameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtape
slaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekvy
elmracwqwnpsdrpsfaeihqafetmfqessi

SCOP Domain Coordinates for d2hzna1:

Click to download the PDB-style file with coordinates for d2hzna1.
(The format of our PDB-style files is described here.)

Timeline for d2hzna1: