Lineage for d2hyda2 (2hyd A:1-323)

  1. Root: SCOP 1.73
  2. 744527Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)
  3. 746557Fold f.37: ABC transporter transmembrane region [90122] (1 superfamily)
    multihelical; complex architecture with several transmembrane helices
  4. 746558Superfamily f.37.1: ABC transporter transmembrane region [90123] (1 family) (S)
  5. 746559Family f.37.1.1: ABC transporter transmembrane region [90124] (2 proteins)
  6. 746566Protein Putative multidrug export ATP-binding/permease protein SAV1866 [144087] (1 species)
  7. 746567Species Staphylococcus aureus [TaxId:1280] [144088] (2 PDB entries)
  8. 746568Domain d2hyda2: 2hyd A:1-323 [136876]
    Other proteins in same PDB: d2hyda1, d2hydb1
    complexed with adp, na

Details for d2hyda2

PDB Entry: 2hyd (more details), 3 Å

PDB Description: Multidrug ABC transporter SAV1866
PDB Compounds: (A:) ABC transporter homolog

SCOP Domain Sequences for d2hyda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hyda2 f.37.1.1 (A:1-323) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}
mikrylqfvkpykyrifatiivgiikfgipmlipllikyaidgvinnhalttdekvhhlt
iaigialfifvivrppiefirqylaqwtsnkilydirkklynhlqalsarfyannqvgqv
isrvindveqtkdfiltglmniwldcitiiialsimffldvkltlaalfifpfyiltvyv
ffgrlrkltrersqalaevqgflhervqgisvvksfaiedneaknfdkkntnfltralkh
trwnaysfaaintvtdigpiivigvgaylaisgsitvgtlaafvgylellfgplrrlvas
fttltqsfasmdrvfqlidedyd

SCOP Domain Coordinates for d2hyda2:

Click to download the PDB-style file with coordinates for d2hyda2.
(The format of our PDB-style files is described here.)

Timeline for d2hyda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hyda1