Class b: All beta proteins [48724] (180 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) |
Family b.43.2.2: AraA C-terminal domain-like [141331] (1 protein) C-terminal part of Pfam PF02610 |
Protein L-arabinose isomerase AraA [141332] (1 species) |
Species Escherichia coli [TaxId:562] [141333] (2 PDB entries) Uniprot P08202 329-498 |
Domain d2hxgc1: 2hxg C:329-498 [136847] Other proteins in same PDB: d2hxga2, d2hxgb2, d2hxgc2 automated match to d2ajta1 complexed with mn |
PDB Entry: 2hxg (more details), 2.8 Å
SCOPe Domain Sequences for d2hxgc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hxgc1 b.43.2.2 (C:329-498) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]} tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf
Timeline for d2hxgc1:
View in 3D Domains from other chains: (mouse over for more information) d2hxga1, d2hxga2, d2hxgb1, d2hxgb2 |