SCOPe 2.02: Domain d2hwnd_: 2hwn D:

Lineage for d2hwnd_ (2hwn D:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein automated matches [190321] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187139] (1 PDB entry)

8. Domain d2hwnd_: 2hwn D: [136829]
   automated match to d1l6ea_
   complexed with gol

Details for d2hwnd_

PDB Entry: 2hwn, 1.6 Å

PDB Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide

PDB Compounds: (D:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOPe Domain Sequences for d2hwnd_:

Sequence; same for both SEQRES and ATOM records:

>d2hwnd_ a.31.1.1 (D:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
shiqippgltellqgytvevlrqqppdlvdfaveyftrlrear

Timeline for d2hwnd_:

• d2hwnd_ first appeared in SCOP 1.73, called d2hwnd1
  
• d2hwnd_ appears in SCOPe 2.01
  
• d2hwnd_ appears in SCOPe 2.03
  
• d2hwnd_ appears in the current release, SCOPe 2.08