SCOP 1.75: Domain d2hwnb1: 2hwn B:5-43

Lineage for d2hwnb1 (2hwn B:5-43)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (2 proteins)

6. Protein cAMP-dependent protein kinase type II regulatory subunit [47393] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47394] (6 PDB entries)

8. Domain d2hwnb1: 2hwn B:5-43 [136827]
   automatically matched to d1l6ea_
   complexed with gol

Details for d2hwnb1

PDB Entry: 2hwn, 1.6 Å

PDB Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide

PDB Compounds: (B:) cAMP-dependent protein kinase type II-alpha regulatory subunit

SCOP Domain Sequences for d2hwnb1:

Sequence; same for both SEQRES and ATOM records:

>d2hwnb1 a.31.1.1 (B:5-43) cAMP-dependent protein kinase type II regulatory subunit {Mouse (Mus musculus) [TaxId: 10090]}
ippgltellqgytvevlrqqppdlvdfaveyftrlrear

Timeline for d2hwnb1:

• d2hwnb1 first appeared in SCOP 1.73
  
• d2hwnb1 is called d2hwnb_ in SCOPe 2.01
  
• d2hwnb1 appears in the current release, SCOPe 2.08, called d2hwnb_